Difference between revisions of "Team:TCU Taiwan/Modeling/Protein structure"
Phoebe chen (Talk | contribs) |
|||
(22 intermediate revisions by 2 users not shown) | |||
Line 9: | Line 9: | ||
} | } | ||
.st { | .st { | ||
− | color: | + | color: black; |
height: 100%; | height: 100%; | ||
width: 100%; | width: 100%; | ||
overflow: auto; | overflow: auto; | ||
margin: 1.2em auto 0; | margin: 1.2em auto 0; | ||
− | text-align: | + | text-align: left; |
border:0px; | border:0px; | ||
border-right:none; | border-right:none; | ||
line-height: 1.4; | line-height: 1.4; | ||
+ | border-bottom-style:none; | ||
} | } | ||
#st1 .inner { | #st1 .inner { | ||
padding:1em 4%; | padding:1em 4%; | ||
+ | border-bottom-style:none; | ||
} | } | ||
#st1 h1{ | #st1 h1{ | ||
Line 27: | Line 29: | ||
#st1 h2{ | #st1 h2{ | ||
background: rgba(255, 255, 255, 0); | background: rgba(255, 255, 255, 0); | ||
+ | border-bottom-style:none; | ||
} | } | ||
Line 34: | Line 37: | ||
</style> | </style> | ||
<body> | <body> | ||
+ | <img src="https://static.igem.org/mediawiki/2015/1/16/2015tcutaiwanModeling.jpg" width="100%" align="center" /> | ||
+ | |||
<div id="st1" class="st"> | <div id="st1" class="st"> | ||
<div class="inner"> | <div class="inner"> | ||
− | < | + | <table width="95%" align="center"> |
− | </font></span> | + | |
− | </ | + | <tr><td align="justify" ><h1><span style="font-family:Arial Black;"><font size="7"><font-weight: 700;> About our modeling</font></span></h1></td></tr> |
+ | <tr><td><h1><span style="font-family:Calibri;text-align:left;"><font size="5"> | ||
+ | To increase efficiency in isolating our AMPs, we introduced a signal peptide upstream of the N-terminal of our AMPs. This signal peptide is obtained from chitinase C of S.lividans (MGFRHKAAALAATLALPLAGLVGLASPAQA). When the fusion peptides enter the periplasmic space, peptidase will identify the cleavage site Ala-Gln-Ala and cut at the double Ala between the signal and AMPs. </br></br> | ||
+ | To ensure and verify this process, we have attached an Ala at the N-terminal of AMPs. When applying a protein secondary structure prediction software base on the known peptide structure, we can analyze whether the attached Ala may have an effect on the peptide folding process. | ||
+ | </br></br> | ||
+ | </font></span></h1></td> | ||
+ | </tr> | ||
+ | </table> | ||
</div> | </div> | ||
</div> | </div> | ||
Line 44: | Line 56: | ||
<div id="st1" class="st"> | <div id="st1" class="st"> | ||
<div class="inner"> | <div class="inner"> | ||
+ | <table width="95%" align="center"> | ||
+ | <tr><td align="left"><h1><span style="font-family:Arial Black;"><font size="7"><font-weight: 700;> Signiferin peptide structure analysis</font></span></h1></td></tr> | ||
+ | <tr> | ||
+ | <td width="90%" align="center"><img src="https://static.igem.org/mediawiki/2015/e/ee/2015tcutaiwanModelingwithoutA1.jpg" align=center width="80%" title="Result 1"></td> | ||
+ | </tr> | ||
+ | </table> | ||
+ | </div> | ||
+ | </div> | ||
+ | <div id="st1" class="st"> | ||
+ | <div class="inner"> | ||
<table width="95%" align="center"> | <table width="95%" align="center"> | ||
− | <td align="center">< | + | |
− | + | <td width="45%" align="center"><img src="https://static.igem.org/mediawiki/2015/f/f8/2015tcutaiwanModelingwithA1.jpg" align=center width="80%" title="Result 1"></td> | |
+ | </tr> | ||
+ | </table> | ||
+ | </div> | ||
+ | </div> | ||
+ | |||
+ | <div id="st1" class="st"> | ||
+ | <div class="inner"> | ||
+ | <table width="95%" align="center"> | ||
+ | <tr><td><h1><span style="font-family:Calibri;text-align:justify;"><font size="5"></br> | ||
+ | The first column shows the amino acid sequence that we predict. | ||
+ | The second column shows that AMPs corresponding secondary structure state are still a-helix. | ||
+ | The third column shows the probability of correct prediction. | ||
+ | </br></br> | ||
+ | </font></span></h1></td></tr> | ||
</table> | </table> | ||
</div> | </div> | ||
Line 56: | Line 92: | ||
<table width="95%" align="center"> | <table width="95%" align="center"> | ||
<tr> | <tr> | ||
− | + | <tr><td align="left"><h1><span style="font-family:Arial Black;"><font size="7"><font-weight: 700;> Epinicedin-1 pepetide structure analysis</font></span></h1></td></tr> | |
− | + | <tr> | |
+ | <td width="45%" align="center"><img src="https://static.igem.org/mediawiki/2015/8/82/2015tcutaiwanModelingepi-1withoutA1.jpg" align=center width="80%" title="Result 4"></td> | ||
</tr> | </tr> | ||
</table> | </table> | ||
Line 67: | Line 104: | ||
<table width="95%" align="center"> | <table width="95%" align="center"> | ||
<tr> | <tr> | ||
− | + | <td width="90%" align="center"><img src="https://static.igem.org/mediawiki/2015/1/10/2015tcutaiwanigemModelingepi-1withA1.jpg" align=center width="80%" title="Result 3"></td> | |
− | + | ||
</tr> | </tr> | ||
</table> | </table> | ||
</div> | </div> | ||
</div> | </div> | ||
+ | |||
<div id="st1" class="st"> | <div id="st1" class="st"> | ||
<div class="inner"> | <div class="inner"> | ||
<table width="95%" align="center"> | <table width="95%" align="center"> | ||
− | + | <tr><td><h1><span style="font-family:Calibri;text-align:justify;"><font size="5"></br> | |
− | + | The first column shows the amino acid sequence that we predict. | |
− | + | The second column shows that AMPs corresponding secondary structure state are still a-helix. | |
+ | The third column shows the probability of correct prediction. | ||
+ | </br></br> | ||
+ | </font></span></h1></td></tr> | ||
+ | </table> | ||
+ | </div> | ||
+ | </div> | ||
+ | |||
+ | |||
+ | <div id="st1" class="st"> | ||
+ | <div class="inner"> | ||
+ | <table width="95%" align="center"> | ||
+ | |||
+ | <tr><td align="center"><h1><span style="font-family:Arial Black;"><font size="7"><font-weight: 700;> Conclusion</font></span></h1></td></tr> | ||
+ | <tr><td><h1><span style="font-family:Calibri;text-align:justify;"><font size="5"></br> | ||
+ | Through the analysis of the peptide secondary structure and confirmation of the -helix structure, the results show whether Ala is attached to Signiferin or Epinecidin-1, the peptide did not affect the peptide folding process. process. | ||
+ | </br></br> | ||
+ | </font></span></h1></td></tr> | ||
</table> | </table> | ||
</div> | </div> |
Latest revision as of 16:38, 18 September 2015
![](https://static.igem.org/mediawiki/2015/1/16/2015tcutaiwanModeling.jpg)
|
To increase efficiency in isolating our AMPs, we introduced a signal peptide upstream of the N-terminal of our AMPs. This signal peptide is obtained from chitinase C of S.lividans (MGFRHKAAALAATLALPLAGLVGLASPAQA). When the fusion peptides enter the periplasmic space, peptidase will identify the cleavage site Ala-Gln-Ala and cut at the double Ala between the signal and AMPs. To ensure and verify this process, we have attached an Ala at the N-terminal of AMPs. When applying a protein secondary structure prediction software base on the known peptide structure, we can analyze whether the attached Ala may have an effect on the peptide folding process. |
|
![]() |
![]() |
The first column shows the amino acid sequence that we predict. The second column shows that AMPs corresponding secondary structure state are still a-helix. The third column shows the probability of correct prediction. |
|
![]() |
![]() |
The first column shows the amino acid sequence that we predict. The second column shows that AMPs corresponding secondary structure state are still a-helix. The third column shows the probability of correct prediction. |
|
Through the analysis of the peptide secondary structure and confirmation of the -helix structure, the results show whether Ala is attached to Signiferin or Epinecidin-1, the peptide did not affect the peptide folding process. process. |
![]() ![]() ![]() ![]() ![]() |
|
Contact us tcutaiwan@gmail.com No.701, Sec. 3, Zhongyang Rd. Hualien 97004, Taiwan |