|
|
(75 intermediate revisions by the same user not shown) |
Line 1: |
Line 1: |
| + | <html> |
| + | <head> |
| | | |
| + | <style type="text/css"> |
| | | |
− | <!-- Start of CSS-->
| + | #contentSub, #contentcontainer, #footer-box, #sitesub, #catlinks, #search-controls, #p-logo, .h3, .printfooter, .firstHeading, .visualClear {display: none;} |
− | <style type="text/css">
| + | |
| | | |
− | /* PAGE LAYOUT */
| + | #globalWrapper, #content { |
| + | width: 100%; |
| + | height: 100%; |
| + | border: 0px; |
| + | background-color: transparent; |
| + | margin: 0px; |
| + | padding: 0px; |
| + | } |
| | | |
− | /* Change Background color*/
| + | html, body, .wrapper { |
− | body {
| + | width: 100%; |
− | background-color: #fff;
| + | height: 100%; |
− | }
| + | background-color: transparent; |
| + | } |
| | | |
− | /* Creates a container that will wrap all of the content inside your wiki pages. */
| |
− | #mainContainer {
| |
− | width: 978px;
| |
− | overflow:hidden;
| |
− | float:left;
| |
− | margin-left:20px;
| |
− | margin-bottom: 10px;
| |
− | background-color: #fff;
| |
− | border-bottom: 14px solid #565656;
| |
− | border-right: 2px solid #565656;
| |
− | border-left: 2px solid #565656;
| |
− | border-top: 2px solid #565656;
| |
− | font-family: "Trebuchet MS", Helvetica, sans-serif;
| |
− | }
| |
| | | |
− | /* Creates the container for the menu */
| |
− | #menuContainer {
| |
− | float:left;
| |
− | width: 134px;
| |
− | padding: 20px 0px;
| |
− | border-top: 14px solid #565656;
| |
− | background-color: #E8E8E9;
| |
− | }
| |
| | | |
− | /* Creates the container for the content */
| + | body { |
− | #contentContainer {
| + | background-color: #F0F0F0; |
− | padding-top:20px;
| + | } |
− | padding-right:10px;
| + | body,td,th { |
− | margin-bottom: 20px;
| + | font-family: Calibri, "新細明體", serif; |
− | width: 814px;
| + | font-size: 12px; |
− | padding-left: 20px;
| + | } |
− | float: left;
| + | p { |
− | background-color: #fff;
| + | margin-top: 0em; |
− | border-top: 14px solid #565656;
| + | margin-bottom: 1.3em; |
− | font-family: "Trebuchet MS", Helvetica, sans-serif;
| + | } |
− | }
| + | |
| | | |
− | /*Set up height place holder for the banner*/
| |
− | #bannerContainer {
| |
− | height:200px;
| |
− | margin:auto;
| |
− | text-align:center;
| |
− | color: #24B694;
| |
− | }
| |
| | | |
− | /*VISUAL STYLE (TABLES, FONTS, LINKS, IMAGES, UL) */
| + | #Wrapper { |
| + | margin-right: auto; |
| + | margin-left: auto; |
| + | padding: 10px; |
| + | background-color: #FFF; |
| + | margin-top: 0px; |
| + | margin-bottom: 0px; |
| + | width: 1130px; |
| + | height: 1000px; |
| + | top: 0px; |
| + | left: 100px; |
| + | right: auto; |
| + | position: absolute; |
| + | bottom: 0px; |
| + | padding-top: 0px; |
| + | padding-bottom: 0px; |
| + | } |
| | | |
− | /*Change the styling of text for everything inside main container*/
| + | .title { |
− | #mainContainer p {
| + | font-size: 1.6em; |
− | font-size: 13px;
| + | } |
− | color: #000000;
| + | .subtitle { |
− | }
| + | top: 10px; |
− |
| + | font-size: 1.3em; |
− | /*This changes the color and font family */
| + | position: relative; |
− | #contentContainer h1, h2, h3, h4, h5, h6 {
| + | } |
− | color: #565656;
| + | |
− | border-bottom: none;
| + | |
− | font-weight: bold;
| + | |
− | font-family: "Trebuchet MS", Helvetica, sans-serif;
| + | |
− | margin-top:10px;
| + | |
− | }
| + | |
| | | |
− | /*Style of the links - links are different inside the menu */
| + | </style> |
− | #contentContainer a {
| + | |
− | font-weight: bold;
| + | |
− | color: #23b593;
| + | |
− | }
| + | |
| | | |
− | /* Styling links on hover- links are different inside the menu */
| + | </head> |
− | #contentContainer a:hover {
| + | |
− | color: #59bf92;
| + | |
− | }
| + | |
| | | |
− | /*Change the styling of tables */
| + | <body> |
− | #contentContainer table {
| + | <div id="Wrapper"> |
− | border: 1px solid #565656;
| + | |
− | border-collapse: collapse;
| + | |
− | width: 90%
| + | |
− | margin: auto;
| + | |
− | margin-bottom: 15px;
| + | |
− | margin-top: 15px;
| + | |
− | margin-right: 10px;
| + | |
− | margin-left: 10px;
| + | |
− | }
| + | |
| | | |
− | /*Change the styling of table cells*/
| + | <p class="title">CPP-PYY complex for appetite suppression</p> |
− | #contentContainer td {
| + | |
− | padding: 10px;
| + | |
− | border: 1px solid #565656;
| + | |
− | border-collapse: collapse;
| + | |
− | vertical-align: text-top;
| + | |
− | }
| + | |
| | | |
− | /*Change the styling of table headers */
| + | <p class="subtitle">Abstract:</p> |
− | #contentContainer th {
| + | <p> As the problem of obesity is becoming a serious issue in Taiwan, more and more unverified weight loss pills are rampant on market. Therefore, we aim to target at the key signal of appetite suppression, Peptide YY, with the help of probiotic Lactobacillus casei as a vector, combining with the most potentially developing delivery drug for cellular uptake of various molecular cargo, Cell Penetrating Peptide (CPP). Ultimately, we expect to design a novelly oral peptide vector where Lactobacillus casei secreting CPP-PYY complex for appetite suppression.</p> |
− | background-color: #E8E8E9;
| + | |
− | padding: 10px;
| + | |
− | border: 1px solid #565656;
| + | |
− | border-collapse: collapse;
| + | |
− | vertical-align: text-top;
| + | |
− | }
| + | |
| | | |
| + | <p class="subtitle">Introduction:</p> |
| + | <p>Peptide YY (PYY) is a protein that suppresses appetite, with the amino acid sequence both beginning and ending with tyrosine (Y), shown as follows:</p> |
| + | <p>YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY</p> |
| + | <p>As a gastrointestinal (GI) hormones, PYY is released for circulation after meals mainly from the L cells of jejunum ileum and colon. Upon reaching hypothalamus by circulation, PYY binds to neuropeptide Y receptor (NPY receptor) in the ventromedial nuclei, which gives fullness feelings.</p> |
| | | |
| + | <p>Cell penetrating peptide (CPP) is a short peptide that is able to bring DNA or protein as cargo for spontaneous penetration through cell membrane, characterized by two mechanisms: Direct penetration and Endocytosis. They share 3 steps in common: membrane interaction, membrane permeation, and CPPs releasing into cytosol.</p> |
| | | |
− | /*MENU STYLING */
| + | <p>Our project design devotes to combining CPP and PYY, with Lactobacillus. casei as a vector, for constructing a dietary supplement for appetite suppression. The CPP-PYY complex secreted from L. casei can effectively pass through the intestine to increase PYY circulation, thus results in appetite inhibition and decrease in food intake, which serves as a cure for obesity.</p> |
| | | |
− | /*Styling for the links in the menu */
| + | <p class="subtitle">Experiments:</p> |
− | #menuContainer a {
| + | <p>There parts are being tested in E. coli for initial examination:</p> |
− | color: #565656;
| + | <ul> |
− | text-decoration:none;
| + | <li>CPP-PYY complex production</li> |
− | font-weight: bold;
| + | <li>Nisin selection</li> |
− | }
| + | <li>Suicide device for safety</li> |
| + | </ul> |
| | | |
− | /* Sets the style for lists inside menuContainer */
| + | </div> |
− | #menuContainer ul {
| + | </body> |
− | list-style: none;
| + | |
− | margin-left:0px;
| + | |
− | }
| + | |
| | | |
− | /*Styles the list items to become menu buttons */
| |
− | #menuContainer ul li {
| |
− | text-align: center;
| |
− | display: block;
| |
− | width: 100%;
| |
− | height:30px;
| |
− | padding-top:10px;
| |
− | }
| |
| | | |
− | /*For the menu buttons, changes the color when hovering*/
| + | |
− | #menuContainer li:hover {
| + | |
− | color: #FFF;
| + | |
− | background-color: #24B694;
| + | |
− | }
| + | |
| | | |
− | /*Submenus are not displayed as default*/
| + | </html> |
− | #menuContainer li ul {
| + | |
− | display: none;
| + | |
− | padding-top:15px;
| + | |
− | margin-left: -19px;
| + | |
− | }
| + | |
− | | + | |
− | /*Submenus are displayed when hovering the menu button */
| + | |
− | #menuContainer li:hover ul {
| + | |
− | /*display: inline-block; */
| + | |
− | display: block;
| + | |
− | position: absolute;
| + | |
− | float:right;
| + | |
− | margin-left: 134px;
| + | |
− | margin-top:-42px;
| + | |
− | }
| + | |
− | | + | |
− | /*Style the submenu buttons*/
| + | |
− | #menuContainer li ul li{
| + | |
− | background-color: #59BF92;
| + | |
− | padding-left:20px;
| + | |
− | padding-right:20px;
| + | |
− | height:30px;
| + | |
− | padding-top:10px;
| + | |
− | margin-top:-2px;
| + | |
− | color: #565656;
| + | |
− | width: 150px;
| + | |
− | }
| + | |
− | | + | |
− | /*CLASSES */
| + | |
− | | + | |
− | /*Clear class for all the pages, adds spacing too*/
| + | |
− | .clear{
| + | |
− | clear:both;
| + | |
− | height: 10px;
| + | |
− | }
| + | |
− | | + | |
− | | + | |
− | /* highlight box for special messages */
| + | |
− | .highlightBox {
| + | |
− | width:500px;
| + | |
− | margin:auto;
| + | |
− | background-color: #E8E8E9;
| + | |
− | margin-bottom: 15px;
| + | |
− | margin-top: 15px;
| + | |
− | padding: 15px;
| + | |
− | padding-top: 5px;
| + | |
− | }
| + | |
− | | + | |
− | | + | |
− | </style>
| + | |
− | <!-- End of CSS -->
| + | |
− | | + | |
− | | + | |
− | <!-- Start of the template html elements. -->
| + | |
− | <div id ="mainContainer"><!--The closing tag for mainContainer should be placed at the bottom of each content page.-->
| + | |
− | | + | |
− | | + | |
− | <div id="bannerContainer">
| + | |
− | <br><br>
| + | |
− | <h2> Add a banner to your wiki! </h2>
| + | |
− |
| + | |
− | <p>You can make the image 980px by 200px</p>
| + | |
− | <p> Remember to call the file: "<i>Team_NTU-LIHPAO-Taiwan_banner.jpg</i>" </p>
| + | |
− | </div>
| + | |
− | | + | |
− | <!-- Start of menu -->
| + | |
− | <div id="menuContainer">
| + | |
− | | + | |
− | <!-- This list is your menu, every list item is a menu button and nested listed become submenu buttons -->
| + | |
− | <ul>
| + | |
− | <a href="https://2015.igem.org/Team:NTU-LIHPAO-Taiwan"><li>HOME</li></a>
| + | |
− | | + | |
− | <a href="https://2015.igem.org/Team:NTU-LIHPAO-Taiwan/Team"><li>TEAM</li></a>
| + | |
− | | + | |
− | <a href="#"><li>PROJECT
| + | |
− | <ul>
| + | |
− | <a href="https://2015.igem.org/Team:NTU-LIHPAO-Taiwan/Abstract"><li>Abstract</li></a>
| + | |
− | <a href="https://2015.igem.org/Team:NTU-LIHPAO-Taiwan/Description"><li>Description</li></a>
| + | |
− | <a href="https://2015.igem.org/Team:NTU-LIHPAO-Taiwan/Experiments"><li>Experiments & Protocols</li></a>
| + | |
− | <a href="https://2015.igem.org/Team:NTU-LIHPAO-Taiwan/Results"><li>Results</li></a>
| + | |
− | <a href="https://2015.igem.org/Team:NTU-LIHPAO-Taiwan/Design"><li>Design</li></a>
| + | |
− | </ul>
| + | |
− | </li></a>
| + | |
− | | + | |
− | <a href="#"><li>PARTS
| + | |
− | <ul>
| + | |
− | <a href="https://2015.igem.org/Team:NTU-LIHPAO-Taiwan/Parts"><li>Team Parts</li></a>
| + | |
− | <a href="https://2015.igem.org/Team:NTU-LIHPAO-Taiwan/Basic_Part"><li>Basic Parts</li></a>
| + | |
− | <a href="https://2015.igem.org/Team:NTU-LIHPAO-Taiwan/Composite_Part"><li>Composite Parts</li></a>
| + | |
− | <a href="https://2015.igem.org/Team:NTU-LIHPAO-Taiwan/Part_Collection"><li>Part Collection</li></a>
| + | |
− | </ul>
| + | |
− | </li></a>
| + | |
− | | + | |
− | <a href="https://2015.igem.org/Team:NTU-LIHPAO-Taiwan/Notebook"><li>NOTEBOOK</li></a>
| + | |
− |
| + | |
− | <a href="https://2015.igem.org/Team:NTU-LIHPAO-Taiwan/Attributions"><li>ATTRIBUTIONS</li></a>
| + | |
− | | + | |
− | <a href="https://2015.igem.org/Team:NTU-LIHPAO-Taiwan/Collaborations"><li>COLLABORATIONS</li></a>
| + | |
− | | + | |
− | <a href="https://2015.igem.org/Team:NTU-LIHPAO-Taiwan/Practices"><li>HUMAN PRACTICES</li></a>
| + | |
− | | + | |
− | <a href="https://2015.igem.org/Team:NTU-LIHPAO-Taiwan/Safety"><li>SAFETY</li></a>
| + | |
− | | + | |
− | <a href="https://2015.igem.org/Team:NTU-LIHPAO-Taiwan/Modeling"><li>MODELING</li></a>
| + | |
− | | + | |
− | <a href="https://2015.igem.org/Team:NTU-LIHPAO-Taiwan/Measurement"><li>MEASUREMENT</li></a>
| + | |
− | | + | |
− | <a href="https://2015.igem.org/Team:NTU-LIHPAO-Taiwan/Software"><li>SOFTWARE</li></a>
| + | |
− | | + | |
− | <a href="https://2015.igem.org/Team:NTU-LIHPAO-Taiwan/Entrepreneurship"><li>ENTREPRENEURSHIP</li></a>
| + | |
− | | + | |
− | </ul>
| + | |
− | </div>
| + | |
− | <!-- End of menu -->
| + | |
− | | + | |
− | <!-- Start of content -->
| + | |
− | <div id="contentContainer"> <!--The closing tag for contentContainer should be placed at the bottom of each content page.-->
| + | |
− | | + | |
− | <h1>CPP-PYY complex for appetite suppression</h1>
| + | |
− | | + | |
− | | + | |
− | Abstract:
| + | |
− | As the problem of obesity is becoming a serious issue in Taiwan, more and more unverified weight loss pills are rampant on market. Therefore, we aim to target at the key signal of appetite suppression, Peptide YY, with the help of probiotic Lactobacillus casei as a vector, combining with the most potentially developing delivery drug for cellular uptake of various molecular cargo, Cell Penetrating Peptide (CPP). Ultimately, we expect to design a novelly oral peptide vector where Lactobacillus casei secreting CPP-PYY complex for appetite suppression.
| + | |
− | | + | |
− | | + | |
− | Introduction:
| + | |
− | Peptide YY (PYY) is a protein that suppresses appetite, with the amino acid sequence both beginning and ending with tyrosine (Y), shown as follows:
| + | |
− | YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY
| + | |
− | As a gastrointestinal (GI) hormones, PYY is released for circulation after meals mainly from the L cells of jejunum ileum and colon. Upon reaching hypothalamus by circulation, PYY binds to neuropeptide Y receptor (NPY receptor) in the ventromedial nuclei, which gives fullness feelings.
| + | |
− | | + | |
− | Cell penetrating peptide (CPP) is a short peptide that is able to bring DNA or protein as cargo for spontaneous penetration through cell membrane, characterized by two mechanisms: Direct penetration and Endocytosis. They share 3 steps in common: membrane interaction, membrane permeation, and CPPs releasing into cytosol.
| + | |
− | | + | |
− | Our project design devotes to combining CPP and PYY, with Lactobacillus. casei as a vector, for constructing a dietary supplement for appetite suppression. The CPP-PYY complex secreted from L. casei can effectively pass through the intestine to increase PYY circulation, thus results in appetite inhibition and decrease in food intake, which serves as a cure for obesity.
| + | |
− | Experiments:
| + | |
− | There parts are being tested in E. coli for initial examination:
| + | |
− | 1. CPP-PYY complex production
| + | |
− | 2. Nisin selection
| + | |
− | 3. Suicide device for safety
| + | |
− | | + | |
− | <a href="https://2015.igem.org/wiki/index.php?title=Team:NTU-LIHPAO-Taiwan/Abstract&action=edit">edit this page</a>
| + | |
CPP-PYY complex for appetite suppression
Abstract:
As the problem of obesity is becoming a serious issue in Taiwan, more and more unverified weight loss pills are rampant on market. Therefore, we aim to target at the key signal of appetite suppression, Peptide YY, with the help of probiotic Lactobacillus casei as a vector, combining with the most potentially developing delivery drug for cellular uptake of various molecular cargo, Cell Penetrating Peptide (CPP). Ultimately, we expect to design a novelly oral peptide vector where Lactobacillus casei secreting CPP-PYY complex for appetite suppression.
Introduction:
Peptide YY (PYY) is a protein that suppresses appetite, with the amino acid sequence both beginning and ending with tyrosine (Y), shown as follows:
YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY
As a gastrointestinal (GI) hormones, PYY is released for circulation after meals mainly from the L cells of jejunum ileum and colon. Upon reaching hypothalamus by circulation, PYY binds to neuropeptide Y receptor (NPY receptor) in the ventromedial nuclei, which gives fullness feelings.
Cell penetrating peptide (CPP) is a short peptide that is able to bring DNA or protein as cargo for spontaneous penetration through cell membrane, characterized by two mechanisms: Direct penetration and Endocytosis. They share 3 steps in common: membrane interaction, membrane permeation, and CPPs releasing into cytosol.
Our project design devotes to combining CPP and PYY, with Lactobacillus. casei as a vector, for constructing a dietary supplement for appetite suppression. The CPP-PYY complex secreted from L. casei can effectively pass through the intestine to increase PYY circulation, thus results in appetite inhibition and decrease in food intake, which serves as a cure for obesity.
Experiments:
There parts are being tested in E. coli for initial examination:
- CPP-PYY complex production
- Nisin selection
- Suicide device for safety