Team:TCU Taiwan/Project/Experimental
![](https://static.igem.org/mediawiki/2015/5/5f/2015tcutaiwanProject.jpg)
Signal Peptide |
In order to have more efficient to get our AMPs, we treated signal peptide upstream of the N-terminal of antimicrobial peptides to facilitate the peptide production. This signal peptide is comes from chitinase C of S.lividans (MGFRHKAAALAATLALPLAGLVGLASPAQA).[1] After translation process signal peptide will lead AMPs to the secretion system of E.coli. [2] When the pre-mature peptides go through the periplasmic space, peptidase will identified the cleavage site Ala-Gln-Ala and cut at the double Ala at the signal and mature peptide linkage site. Then separate signal peptide from AMPs. Finally, secreting AMPs to the LB culture medium.
|
|
Contact us tcutaiwan@gmail.com No.701, Sec. 3, Zhongyang Rd. Hualien 97004, Taiwan |