Team:Minnesota/Parts

Add a banner to your wiki!

You can make the image 980px by 200px

Remember to call the file: "Team_Minnesota_banner.jpg"

Part Documentation

Each team will make new parts during iGEM and will submit them to the Registry of Standard Biological Parts. The iGEM software provides an easy way to present the parts your team has created. The <groupparts> tag (see below) will generate a table with all of the parts that your team adds to your team sandbox.

Remember that the goal of proper part documentation is to describe and define a part, so that it can be used without needing to refer to the primary literature. Registry users in future years should be able to read your documentation and be able to use the part successfully. Also, you should provide proper references to acknowledge previous authors and to provide for users who wish to know more.

Note

Note that parts must be documented on the Registry. This page serves to showcase the parts you have made. Future teams and other users and are much more likely to find parts by looking in the Registry than by looking at your team wiki.

CrtE

Protein data table for BioBrick BBa_ automatically created by the BioBrick-AutoAnnotator version 1.0

Nucleotide sequence in RFC 10: (underlined part encodes the protein)
ATGGTCACA ... AGGGATCGTTAA
ORF from nucleotide position 1 to 900 (excluding stop-codon)

Amino acid sequence: (RFC 25 scars in shown in bold, other sequence features underlined; both given below)

1
101
201
301

MVTAVRTEFDFAAYLRAARESVELALDGSLGTERPTSLSEAMRYSLLAGGKRLRPILCLAACELAGGNVAAAMPTAVALEMIHTMSLIHDDLPAMDNDDL
RRGRPTNHKVYGEATAILAGDALLTRAFEIVALRSPGVSPECILKVIGELSLAAGAPGLVGGQMVDLESEGKEVNLDTLEYIHLHKTGALLSACVICGGL
IGDASDELLQALRNYARGIGLAFQIIDDILDVTASSDVLGKTAGKDLVADKTTYPKLLGLKASRERAEQLVAEAKQGLDPWRDRAAPLLALADYITGRDR
*

Sequence features: (with their position in the amino acid sequence, see the list of supported features)

None of the supported features appeared in the sequence

Amino acid composition:

Ala (A)	43 (14.3%)
Arg (R)	20 (6.7%)
Asn (N)	5 (1.7%)
Asp (D)	22 (7.3%)

Cys (C)	5 (1.7%)
Gln (Q)	5 (1.7%)
Glu (E)	19 (6.3%)
Gly (G)	27 (9.0%)

His (H)	5 (1.7%)
Ile (I)	15 (5.0%)
Leu (L)	45 (15.0%)
Lys (K)	11 (3.7%)

Met (M)	7 (2.3%)
Phe (F)	4 (1.3%)
Pro (P)	11 (3.7%)
Ser (S)	15 (5.0%)

Thr (T)	16 (5.3%)
Trp (W)	1 (0.3%)
Tyr (Y)	7 (2.3%)
Val (V)	17 (5.7%)

Amino acid counting

	Total number:	300
	Positively charged (Arg+Lys):	31 (10.3%)
	Negatively charged (Asp+Glu):	41 (13.7%)
	Aromatic (Phe+His+Try+Tyr):	17 (5.7%)

Biochemical parameters

	Atomic composition:	C₁₃₉₆H₂₂₉₂N₃₉₂O₄₃₁S₁₂
	Molecular mass [Da]:	31848.6
	Theoretical pI:	5.08
	Extinction coefficient at 280 nm [M^-1 cm^-1]:	15930 / 16243 (all Cys red/ox)

Plot for hydrophobicity, charge, predicted secondary structure, solvent accessability, transmembrane helices and disulfid bridges

Codon usage

	Organism:	E. coli	B. subtilis	S. cerevisiae	A. thaliana	P. patens	Mammals
	Codon quality (CAI):	good (0.70)	good (0.76)	good (0.74)	good (0.74)	good (0.76)	good (0.62)

Alignments (obtained from PredictProtein.org)
There were no alignments for this protein in the data base. The BLAST search was initialized and should be ready in a few hours.

Predictions (obtained from PredictProtein.org)

There were no predictions for this protein in the data base. The prediction was initialized and should be ready in a few hours.

The BioBrick-AutoAnnotator was created by TU-Munich 2013 iGEM team. For more information please see the documentation.
If you have any questions, comments or suggestions, please leave us a comment.

CrtB

Protein data table for BioBrick BBa_ automatically created by the BioBrick-AutoAnnotator version 1.0

Nucleotide sequence in RFC 10: (underlined part encodes the protein)
ATGCTGAAC ... GGTTCCGACTGA
ORF from nucleotide position 1 to 1017 (excluding stop-codon)

Amino acid sequence: (RFC 25 scars in shown in bold, other sequence features underlined; both given below)

1
101
201
301

MLNESQVEAGKEIQQRTGKTFYFATRLLPERVRHATYVLYAFFRVADEVVDAEETAPPEQQRERLERLRAEALGDVETGDPVLSAFAELREQYDIDPDDV
NVFIDAMESDIHKDRHATYEELETYMDGSASAVGRMMTAVMRPDDPKQALPHATALGQAFQLSNFLRDVGEDVVERDRVYLPETTLERHGVDVAQILDLE
FDDRVAEVMRDELRRAESLYRDGVAGIEYLPHDCQFPVLLSAVLYADHHRSIRKLGYDTLSTTPDLSFGRKVFLLGKTAAYWAVWRDPVAVFKAVSVVPY
PEDEEFDADFGPGSTPVGKVRSRGRVSGWIRALSRWGSD*

Sequence features: (with their position in the amino acid sequence, see the list of supported features)

None of the supported features appeared in the sequence

Amino acid composition:

Ala (A)	33 (9.7%)
Arg (R)	31 (9.1%)
Asn (N)	3 (0.9%)
Asp (D)	32 (9.4%)

Cys (C)	1 (0.3%)
Gln (Q)	11 (3.2%)
Glu (E)	30 (8.8%)
Gly (G)	20 (5.9%)

His (H)	8 (2.4%)
Ile (I)	8 (2.4%)
Leu (L)	30 (8.8%)
Lys (K)	9 (2.7%)

Met (M)	7 (2.1%)
Phe (F)	15 (4.4%)
Pro (P)	17 (5.0%)
Ser (S)	17 (5.0%)

Thr (T)	17 (5.0%)
Trp (W)	4 (1.2%)
Tyr (Y)	13 (3.8%)
Val (V)	33 (9.7%)

Amino acid counting

	Total number:	339
	Positively charged (Arg+Lys):	40 (11.8%)
	Negatively charged (Asp+Glu):	62 (18.3%)
	Aromatic (Phe+His+Try+Tyr):	40 (11.8%)

Biochemical parameters

	Atomic composition:	C₁₇₀₃H₂₆₃₇N₄₇₅O₅₂₅S₈
	Molecular mass [Da]:	38422.0
	Theoretical pI:	4.79
	Extinction coefficient at 280 nm [M^-1 cm^-1]:	41370 / 41433 (all Cys red/ox)

Plot for hydrophobicity, charge, predicted secondary structure, solvent accessability, transmembrane helices and disulfid bridges

Codon usage

	Organism:	E. coli	B. subtilis	S. cerevisiae	A. thaliana	P. patens	Mammals
	Codon quality (CAI):	good (0.70)	good (0.76)	good (0.73)	good (0.74)	good (0.75)	good (0.66)

Alignments (obtained from PredictProtein.org)
There were no alignments for this protein in the data base. The BLAST search was initialized and should be ready in a few hours.

Predictions (obtained from PredictProtein.org)

Subcellular Localization (reliability in brackets)

	Archaea:	arc (%)
	Bacteria:	bac (%)
	Eukarya:	euk (%)

Gene Ontology (reliability in brackets)

	Molecular Function Ontology:	0005515 0. (NaN%), 0004310 0. (NaN%)
	Biological Process Ontology:	0016117 0. (NaN%), 0015995 0. (NaN%)

Predicted features:

	Disulfid bridges:	-
	Transmembrane helices:	-

The BioBrick-AutoAnnotator was created by TU-Munich 2013 iGEM team. For more information please see the documentation.
If you have any questions, comments or suggestions, please leave us a comment.

CrtI

Protein data table for BioBrick BBa_ automatically created by the BioBrick-AutoAnnotator version 1.0

Nucleotide sequence in RFC 10: (underlined part encodes the protein)
ATGGATGAC ... TTGTCCACTTAA
ORF from nucleotide position 1 to 1278 (excluding stop-codon)

Amino acid sequence: (RFC 25 scars in shown in bold, other sequence features underlined; both given below)

1
101
201
301
401

MDDSHIVVVGAGLAGLVAARHLAVDGADVTVIERRDDVGGRVRTRTKDGFTLDRGFQVLLTGYPAVRRELDFDALDLRPLAPGATICRPSRRSVLSDPLR
DINGLFDSLRNPEVTTSDKLRTLALRQDVSTRDEGEIFDSPDQSIRAYLRDWGFSEDFIEHFVAPFYGGITLDRSLSTSKRVFEYTFKMLATGRAAVPAD
GMQAIPEQLAATARDEGATIRLGERVESVQSDADGAVVATDDESVEADAVVVATDPKEARRLTGVGSIPTDARGCVTQYYTLPTGSGLDAGKRIMLNAPN
PDPNTVVPLSTVAPEYAPPGKELLNATFLGAAAQDESEEELFEKTRRTLEAWYPERYFDDLELLHTDYISFAQFAQPPEIHDSLPDHRDAPGRTYLAGDY
TAWSSIQGAMRSGKEAADAIRDDLST*

Sequence features: (with their position in the amino acid sequence, see the list of supported features)

None of the supported features appeared in the sequence

Amino acid composition:

Ala (A)	48 (11.3%)
Arg (R)	37 (8.7%)
Asn (N)	6 (1.4%)
Asp (D)	44 (10.3%)

Cys (C)	2 (0.5%)
Gln (Q)	11 (2.6%)
Glu (E)	27 (6.3%)
Gly (G)	32 (7.5%)

His (H)	6 (1.4%)
Ile (I)	16 (3.8%)
Leu (L)	39 (9.2%)
Lys (K)	9 (2.1%)

Met (M)	5 (1.2%)
Phe (F)	16 (3.8%)
Pro (P)	25 (5.9%)
Ser (S)	26 (6.1%)

Thr (T)	32 (7.5%)
Trp (W)	3 (0.7%)
Tyr (Y)	12 (2.8%)
Val (V)	30 (7.0%)

Amino acid counting

	Total number:	426
	Positively charged (Arg+Lys):	46 (10.8%)
	Negatively charged (Asp+Glu):	71 (16.7%)
	Aromatic (Phe+His+Try+Tyr):	37 (8.7%)

Biochemical parameters

	Atomic composition:	C₂₀₃₇H₃₂₀₆N₅₇₈O₆₅₆S₇
	Molecular mass [Da]:	46513.8
	Theoretical pI:	4.65
	Extinction coefficient at 280 nm [M^-1 cm^-1]:	34380 / 34505 (all Cys red/ox)

Plot for hydrophobicity, charge, predicted secondary structure, solvent accessability, transmembrane helices and disulfid bridges

Codon usage

	Organism:	E. coli	B. subtilis	S. cerevisiae	A. thaliana	P. patens	Mammals
	Codon quality (CAI):	good (0.69)	good (0.73)	good (0.74)	good (0.76)	good (0.79)	good (0.67)

Alignments (obtained from PredictProtein.org)
There were no alignments for this protein in the data base. The BLAST search was initialized and should be ready in a few hours.

Predictions (obtained from PredictProtein.org)

Subcellular Localization (reliability in brackets)

	Archaea:	arc (%)
	Bacteria:	bac (%)
	Eukarya:	euk (%)

Gene Ontology (reliability in brackets)

	Molecular Function Ontology:	0050660 0. (NaN%), 0080103 0. (NaN%)
	Biological Process Ontology:	0015995 0. (NaN%), 0015979 0. (NaN%)

Predicted features:

	Disulfid bridges:	-
	Transmembrane helices:	-

The BioBrick-AutoAnnotator was created by TU-Munich 2013 iGEM team. For more information please see the documentation.
If you have any questions, comments or suggestions, please leave us a comment.

We encourage teams to start completing documentation for their parts on the Registry as soon as you have it available. The sooner you put up your parts, the better you will remember all the details about your parts. Remember, you don't need to send us the DNA sample before you create an entry for a part on the Registry. (However, you do need to send us the DNA sample before the Jamboree. If you don't send us a DNA sample of a part, that part will not be eligible for awards and medal criteria.)

What information do I need to start putting my parts on the Registry?

The information needed to initially create a part on the Registry is:

Part Name
Part type
Creator
Sequence
Short Description (60 characters on what the DNA does)
Long Description (Longer description of what the DNA does)
Design considerations

We encourage you to put up much more information as you gather it over the summer. If you have images, plots, characterization data and other information, please also put it up on the part page.

Inspiration

We have a created a <a href="http://parts.igem.org/Well_Documented_Parts">collection of well documented parts</a> that can help you get started.

You can also take a look at how other teams have documented their parts in their wiki:

<a href="https://2014.igem.org/Team:MIT/Parts"> 2014 MIT </a>
<a href="https://2014.igem.org/Team:Heidelberg/Parts"> 2014 Heidelberg</a>
<a href="https://2014.igem.org/Team:Tokyo_Tech/Parts">2014 Tokyo Tech</a>

Part Table

</html> <groupparts>iGEM015 Example</groupparts>

Team:Minnesota/Parts

Add a banner to your wiki!

Part Documentation

Note

Contents

Adding parts to the registry

What information do I need to start putting my parts on the Registry?

Inspiration

Part Table